Article Type : Research Article
Authors : Chakraborty AK
Keywords : XEC,NCBI Virus, Amino acids, Polyprotein
XEC
variant was generated due to recombination between JN.1-lineages KP.3.3 and
KS.1.1 subvariants. Multi-alignments among the XEC,KP.3.3 and KS.1.1 sequences
at the NCBI Virus Portal suggested nt.21600-29900 originated from KP.3.3.
Similarly, BLASTP-2 mutational differences between XEC/KP.3.3 and XEC/KS.1.1
genome confirmed the positions of XEC recombination. The sixty amino acids of
N-terminus were generated from KS.1.1 as confirmed by BLASTP-2 analysis of
spike proteins of XEC/KP.3.3 and XEC/KS.1.1. The ORF1ab polyprotein BLASTP-2
analysis suggested that AAs 2200-2300 region generated from KS.1.1 as T2283I
mutation was only found in KP.3.3. While AAs 2100-2200 was originated from
KP.3.3 as L2146F mutation was only found in KS.1.1. Interestingly, the A599T
ORF1ab mutation in XEC was found but was not located in both KP.3.3 and KS.1.1.
BLASTP analysis of 60 AAs of the mutated region suggested that FL.15 subvariant
recombination between nt.450-650 might be occurred in XEC. The SWISS-Modelling
suggested the PCov_GX spike (PDB: 7cn8.1) template gave the best fit 3-D model
for XEC spike protein but JN.1 spike (PDB: 8y5j.1.A) template produced more
compact 3-D trimeric spike and had 99.08% similarity as compare to 88.72%
former. The bat spike (PDB: 8wly.1.B) template gave very open 3-D motif of
LB.1.7 and KP.3.1.1 oligomeric spikes with protruding amino acids but no
symmetry among three identical subunits. The parameters of SWISS-Modelling
suggested that XEC variant spike oligomer is a more compact to interact with
receptor explaining higher transmission rate and higher pathogenicity than
parent JN.1 subvariants or precedent BA.2.86 variant.
About seven million people were died due to corona
virus infection worldwide between 2019 2024 [1,2]. Currently, six different
coronavirus strains are known to infect humans. Such strains named as:
HCoV-229E (229E), HCoV-OC43 (OC43), SARS-CoV (COVID-19), HCoV-NL63 (NL63),
HCoV-HKU1 (HKU1), and MERS (MERS-CoV) [3,4]. COVID-19 has unique polyprotein (ORF1a,
ORF1b), antigenic spike protein (S), and small regulatory proteins like orf3a,
orf7a, orf8 and orf10 (Figure 1). The RNA polymerase (Nsp12), Proteases (Nsp3
and Nsp5), RNA topoisomaerse (Nsp2), Capping RNA helicase (Nsp13), RNAases
(Nsp14, Nsp15) and Methyltransferase (Nsp16) were produced from the proteolysis
of ORF1ab [5,6]. The COVID-19 first appeared in China during 2019 through the
recombination among bat and pangolin corona viruses [7]. Vaccination and
autoimmunity greatly controlled the alpha, beta and delta coronaviruses
epidemic in during 2020-2022 but omicron coronaviruses (since November, 2021
and more than 149 countries) mild infections were still happening today [8-10].
Never-the-less patients with co morbidity and old age still are dying due to
omicron BQ.1 (September, 2022), XBB.1.5 (and JN.1 (May 2024) sub variants
infections. United States and United Kingdom are continuing their WGS sequence
analysis from sample isolated from newly omicron coronavirus infected people.
The great VOC of coronavirus classification were Alpha with dominant N501Y
spike mutation, Delta with dominant D614G, L452R, K444R, T478K, Y508H and P681R
spike mutations including P1, P2, Beta and Gamma and few omicron variants that
affected greatly between 2020-2023 [11,12]. While Omicron BA.1 followed by
BA.2, BA.3 (only Africa), BA.4 and BA.5 affected with great specificity
worldwide between 2022-2023 with lower severity, the recent XEC variant was
reported as a new threat [13]. There are 21 common mutations between BA.1,
BA.2, and BA.3 which are G142D, G339D, S373P, S375F, K417N, N440K, S477N,T478K,
E484A, Q493R, Q498R, N501Y, Y505H, D614G, H655Y, N679K, P681H, N764K, D796Y,
Q954H,and N969K [14]. The XBB variant outbreaks was maximum which was made by
recombination with two second-generation BA.2 lineages, BJ.1 (BA.2.10.1.1) and
BA.2.75; and it contained a large number of antigenic receptor-binding domain
mutations and was shown to be poorly neutralized by previous Omicron
breakthrough antisera [15]. The major point mutations in the spike protein of
JN.1 omicron coronavirus were demonstrated in (Table 1) Apart from that 17MPLF
spike insertion is an important characteristic of JN.1 subvariants. Although,
7% JN.1 lineages had no such insertion as reported by Howard D et al contrary
to Oppentrons P who suggested major JN.1 subvariants had no such insertion
[16,17]. However, such insertion favoured the eight to nine amino acids
deletions [24LPP, (31S), 69HV, 145Y, 211N and 483V].We did not find yet the 31S
deletion in XEC variant but in LB.1.7 subvariant, we detected 100% 31S
deletion. The JN.1 variant and XEC variant both are threat as both dominant
N501Y and D614G mutations accumulated enhancing transmission. Recently, Howard
et al found about 5-7% omicron coronaviruses with no 17MPLF spike insertion but
few European laboratories had submitted more JN.1 sequences without 17MPLF
spike insertion. Further, NH2-terminas in JN.1 spike accumulated many mutations
other than 315-525 AAs RBD region. Comparatively we found all omicron sub-lineages
including BA.5, BQ.1.1, XBB.1.5 and JN.1 had less mutations in the 700-1269 AAs
Carboxy-terminal region of spike [18]. Recombination among the coronavirus
variants were seen from time to time and sometime such recombinant virus had
higher transmission and pathogenicity (Table 2). The XEC coronavirus, a
recombinant between KP.3.3 and KS.1.1, was first identified in Berlin in late
June and has since grown rapidly across Europe, North America, and Asia, with
the most significant increases observed in Germany and Denmark (September,
2024). The major symptoms are loss of sense of taste or smell, shortness of
breath, runny nose, sore throat, congestion, diarrhea, fever or chills and
fatigue. Scientists believe that the existing vaccinations targeting Omicron
variants will likely continue to be effective against XEC. But exiting drugs
like paxlovid (PLpro/Mpro proteases inhibitors) and remdesivir (Rd-RNA
Polymerase inhibitor) were approved by FDA whereas immune drugs tocilizumab
(cytokine IL-6 antagonist) and baricitinib (Janus kinase inhibitor) might be
useful. During March 2020 initial report suggested that human SARS-CoV-2
(COVID-19) might be originated from pangolins and later other report suggested
that bat origin of human coronaviruses [19]. SARS-CoV-2’s entire
receptor-binding motif (RBM) was introduced through recombination with
coronaviruses from pangolins, possibly a critical step in the evolution of
SARS-CoV-2’s ability to infect humans. The human seasonal coronaviruses all
have recombination rates around 1?×?10?5 per site and year and satisfies a role
of pathogenicity [20,21]. The highest subvariant was reported to be KP.3.1.1
(>50%) followed by KP.2.3, KP.3.3, LB.1.7 (>10%) and JN.1.11.1.2,
JN.1.16.1 and KS.1.1 (<3%). The KP.3.1.1 had extra 31S deletion in addition
to F456L, Q493E and V1104L spike point mutations that appeared in KP.3. The
LB.1.7 had JN.1 mutations plus LB.1 specific Q183H, R346T and F456L pint
mutations including new 31S deletion. The XEC spike had JN.1 mutations
including T22N, F59S, F456L, Q493E and V1104L point mutations but no 31S spike
deletion [22]. US statistics on coronavirus spread was reliable and whole
genome sequencing by Howard D et al was highly satisfactory. As on 5th May 2022
confirmed Pangolin COVID-19 cases in India 37542 and in USA 999565 while GISAID
cases (29TH July, 2022) in India 81017 and in USA 1431772. Thus, I preferred to
study NCBI virus free database which at least clearly gave an idea of COVID-19
spread. The CDC estimated that the JN.1 variant accounted for 44% of cases in
the US on 22th December 2023 and 62% of cases on 5th January 2024. The genesis
of XEC variant was discussed and Swiss Model used to predict the spike protein
structural differences with JN.1.
The sequences of XEC variant were obtained from
SARS-CoV-2 database (NIH, USA). The multi-alignment of at least six sequences
performed to show same structural integrity before Swiss-Modelling. The BLASTP
performed to show spike protein homology between two amino acid sequences.
CLUSTAL-Omega multi-alignments were performed to see protein or DNA homologies
among different coronavirus genomes or spike proteins. Emboss transeq was used
to convert nucleotide sequence to protein. Protein domains of SARS-CoV-2 was
identified using Pfam, InterPro, and SMART protein domain annotation server.
Clustal W and Mafft was used for multiple sequence alignments. The PDB was
utilized to get the cryo?electron microscopy (cryo?EM) structure of the
SARS?CoV?2 Omicron (BA.1) spike protein in complex with human ACE2 (refinement
of RBD and ACE2; PDB ID: 7T9L). The structure of BA.1.1 and BA.2 was generated
by homology modelling with SWISS?MODEL server with the BA.1 template (PDB:
7T9L) [23]. Similarly, the N?terminal domain (NTD) of spike protein was
modelled using SWSS?MODEL server: WT (PDB ID: 7L2C), BA.1 (PDB ID: 7TEI) and
BA.2 (PDB ID: 7TO4) [24]. We compared Wuhan Bat origin (PDB: 8WLY). Wuhan
pangoline origin (PDB: 7CN8) and JN.1 (PDB: 8Y5J).
The JN.1 is class of omicron COVID-19 and spike amino
acid differences with Wuhan has shown in (Table 1) while the XEC is a
recombinant lineage of JN.1 lineages as has shown in (Figure 2).
Multi-alignment is a good approach to locate the similarities among the
different coronavirus genomes to locate the genesis of recombinant variant. In
(Table 2) we have shown few recombinant coronaviruses. We multi-aligned many
sequences (200) to check the variation among sequences including 17MPLF
insertion in spike and 26-49nt deletion in the 3’-UTR. In (Figure 3A), we
showed the NCBI SARS-CoV-2 portal analysis of XEC, KP.3.3 and KS.1.1 sequences
indicating at least 3’-end (nt. 21700-29900) of XEC originated from KP.3.3.
Next, we performed BLASTN-2 analysis between XEC/KP.3.3 and XEC/KS.1.1 to get
mutational differences throughout the genome of KP.3.3 and KS.1.1. Such
analysis was summarized in (Figure 3B) to confirm the genesis of XEC 3’-end
from KP.3.3 (as many mutations at that region with XEC/KS.1.1) while middle
part (nt.11000-21000) might be generated from KS.1.1. To verify the
recombination point, we studied the BLASTP-2 analysis between spike, ORF1ab and
N proteins of XEC/KP.3.3 and XEC/KS.1.1. The (Figure 4A) demonstrated the huge
mutation in AAs 1-60 between XEC/KP.3.3 suggesting that part was obtained from
KS.1.1. That means we narrowed the recombination point at the 3’ end of XEC at
the spike N-terminus. The (Figure 4B) confirmed the homology of KS.1.1 at spike
NH2 terminus 60AAs but no similarity at the C-terminus. We also checked the
BLASTP-2 between spike of KP.3.3 and KS.1.1 showing the said differences at the
NH2-terminus (Figure 5). We also checked the BLASTP-2 of N-protein between
KP.3.3/ KS.1.1 or XEC/KP.3.3 and XEC/KS.1.1 (Figure 6). In Figure 6A we showed
the N-protein variation between KP.3.3/KS.1.1 which was also seen between
XEC/KS.1.1 confirming 3’-end generated from KP.3.3 (Figure 6B). To note that
there was 100% homology between BLASTP-2 of XEC/KP.3.3 (data not shown).To
confirm the 5’-end junctions in XEC, we performed the multi-alignment of ORF1ab
protein of XEC, KP.3.3 and KS.1.1 using MultAlin software (Figure 7). In Figure
7A, we showed an A599T mutation in XEC but not found in KP.3.3 and KS.1.1. The
60 AAs BLASTP search demonstrated many XEC sequences but few FL.15 sequences
(WQR02769 and WOH26089) were obtained suggesting that such variant might be
involved in the genesis of nsp2 protein (2nd protein of ORF1ab polyprotein). We
got the protein id through BLASTP search and to get the sub variant status we
had gone to SARS-CoV-2 portal at the respective accession numbers and checked
the variant status as FL.15 (accession numbers: PP042317 and OR707598). We also
got the sequences from 2021 year (UBW36984 and UDA43273) and was hardly able to
find the variant status at the portal (20000 pages were not possible to open).
So, we check the spike protein through the BLASTP-2 search with Wuhan spike
(YP_009724390) to confirm the 157FR deletion (protein id. UBW36986 and
UDA43274) suggesting A599T mutation in ORF1ab of FL.15 might be obtained from
Delta variant (data not shown).During ORF1ab proteins multi-alignment, we also
got L2146F mutation in KS.1.1 (Figure 7B) while T2283I mutation in KP.3.3
(Figure 7C) to conclude the boundary of recombination at the 5’-end. So, it was
concluded that from ORF1ab 2200 AAs to spike 70 AAs (nt. 6793-21691; accession
number: PQ380322) was originated from KS.1.1 and then again part 650-2199 AAs
(nt. 2143-6790) of ORF1ab was originated from KP.3.3. Critical point was our
data that supported that 3’-end of XEC (nt.1-2142) was originated from FL.15
sequence. However, 3’-end had mutations as judged by BLASTN-2 search between
XEC/FL.15 (Figure 8). The PQ380322 (XEC) vs OR707598 (FL.15) or PP042317
(FL.15) produced three or more mutations at the 3’-end of XEC sequence
comparison as shown in Figure 9. Thus, a very narrow position in nsp2 gene
(~nt.450-650) of XEC was obtained from FL.15 might be possible. Such region had
no mutation between XEC/KP.3.3 (PQ380322 vs PQ206638) and XEC/KS.1.1 (PQ380322
vs PQ380361) (data not shown). We repeated the experiment with another XEC
sequence (PQ386636) and FL.15 sequences (OR707598 and PP042317) producing same
results. The important XEC point mutations and their penetration in the
Database was shown in Table 3.
We next determined the 3-S structural differences
between JN.1 and XEC as compared to Wuhan (Figure 10). The best fit trimeric 3D
structure obtained with 7cn8.1.A template © and Model-1 with 8wly.1.B template
and Model-4 with 8xut.1. A template made protruding amino acids (open
complex).Next, we compared the 3D Swiss Modelling structures of spike protein
of JN.1, XEC, KP.3.1.1 and LB.1.7 subvariants (Figure 11). We always found that
template 7cn8.1.A was good even it had 88% similarity to JN.1 lineages while
KP.3.1.1 gave more compact structures indicating its fitness to interact with
ACE-2 receptor of lungs cells. Using 8y5j.1.A template with 99% similarity, the
XEC coronavirus spike gave lower QMQE (0.63 vs. 0.66) but Clash score as
compared to KP.3.1.1 subvariant (Table 4) while the MolProbity score was higher
(1.30 vs. 1.27). We found that JN.1 spike had advantage trimeric structure due
to lowest clash score using all templates (8wly.1.B=0.63; 7cn8.1.A=0.68 and
8y5j.1.B=0.48). The lowest MolPrrobity (1.21) and Clash score (0.45) in LB.1.7
indicated its spread at certain point but likely due to new mutations in spike
such spread was diminished now. The higher stability of KP.3.1.1 with better
transmission might be occurred due to lower bad bonds (bad bonds=2) which was
higher in JN.1 (bad bonds=7) including lower bad angles (172 vs 188). (Figure
12) showed the difference in the single subunit structure of Wuhan virus spike
as compared to XEC and KP.3.1.1. It was found that XEC and KP.3.1.1 made a
sword structure at the RBD domain and such structure was reported as the better
fitness for spike of XEC and KP.3.1.1 sub variants to interact better with ACE-2
receptor. Thus, the fitness of KP.3.1.1 and XEC depend on the acquisition new
mutations in the spike. Mutational analysis suggested that spike Q180H and
R187T mutations in KP.3.1.1 (accession number: PQ426785) had already occurred.
However, 49nt deletion in the 3’-UTR surely deleterious for any coronavirus and
we claimed that pre-death symptoms were initiated in coronavirus.
Figure 1: Structure of a 100nm omicron coronavirus (Mousavizadeh L, Ghasemi S. Genotype and phenotype of COVID-19: Their roles in pathogenesis. J Microbiol Immunol Infect. 2021; 54(2): 159-163).
Figure 2: Phylogenetic tree of COVID-19 variants showing
distances and bootstrap values. Multi-alignment showed that C-terminal 155
amino acids (NTF VSG NCD VVI GIV NNT VYD PLQ LEL DSF KEE LDK YFK NHT SPD VDL
GDI SGI NAS VVN IQK EID RLN EVA KNL NES LID LQE LGK YEQ YIK WPW YIW LGF IAG LIA
IVM VTI MLC CMT SCC SCL KGC CSC GSC CKF DED DSE PVL KGV KLH YT-COOH) were
identical in all subvariants analyzed here.
The JN.1 is a distinct class and XEC plus KP.3.1.1 aligned being very
similar with 31S deletion in the spike.
Figure
3:
Determination of KP.3.3 and KS.1.1 regions during the generation of XEC
variant. Fig.2A denoted by SARS-CoV-2 portal multi-alignment demonstrating the
mutations points by red lines. The KP.3.3 3’-end matched with XEC but many red
lines with KS.1.1. Fig.2B made by observing the BLASTN-2 mutations between
XEC/KP.3.3 and XEC/KS.1.1 genomes. The less mutations suggested the regions of
XEC genome formation. Green line indicated KP.3.3 regions and blue line denoted
the KS.1.1 regions in XEC genome.
Figure 4: BLASTP-2 sequence similarities of spike between XEC/KP.3.3 variants and XEC/KS.1.1 variants. As 60 amino acids had the maximum differences with XEC with KP.3.3, such region was obtained from KS.1.1. So, recombination was occurred after 60AAs of spike of KP.3.3 and KS.1.1.
Figure 5: Spike amino acid differences between KP.3.3 and
KS.1.1 sub variants. Parts of the alignment with mutations only were shown
here.
Figure 6: Amino acid differences between N-protein of KP.3.3/KS.1.1, XEC/KP.3.3 and XEC/KS.1.1 variants as demonstrated by BLASTP-2. The XEC/KP.3.3 N-protein had no mutation (data not shown) confirming again that 3’-end of XEC variant was originated from KP.3.3 sub variant.
Figure
7A:
Multi-alignment of ORF1ab polyprotein of XEC, KP.3.3 and KS.1.1 variants to
find a portion of sequence may be obtained from FL.15 sub variants.
Figure 7B: Multi-alignment as in figure-5 to demonstrate that part of XEC sequence (ORF1ab AAs at the L2146F boundary) obtained from KP.3.3 sub variant.
Figure
7C:
Multi-alignment as in figure-5 to demonstrate that part of XEC sequence (ORF1ab
AAs at the T2283I mutation boundary) obtained from KS.1.1 sub variant
Figure 8: BLASTN-2 demonstration between XEC (PQ380322) and FL.15 (PP042317) that 3’-end was generated from KP.1.1 or KS.1.1 but not from FL.15 as few mutations were seen. Note that such region did not contain any mutation between BLASTN-2 of XEC/KP.3.3 or XEC/KS.1.1 (PQ380322 vs PQ206638 or PQ380322 vs PQ380361).
Figure
9:
The BLASTP-2 similarities between spike of XEC variant and LB.1.7 sub variant.
The only NH2-terminus position was shown here. The both sequences contained
17MPLF spike insertion and 24LPP and 69HV deletions. The 31S deletion was not
found with XEC variant and might be seen later. The N26T, S60F, Q181H point
mutations might be significant and R343T, E489Q, L1100V and Q1198E mutations
were not shown here. The spike of LB.1.7 variants with accession numbers
PQ211287, PQ211379, PQ211386, PQ211432, PQ211449, PQ211461, PQ211608, PQ211628,
PQ211731, PQ211740 and PQ211834 had similar spike sequences.
Figure 10: Swiss-Modelling of XEC variant spike with four templates. The best fit oligomeric 3D structure obtained with 7cn8.1.A template © and Model-1 with 8wly.1.B template and Model-4 with 8xut.1.A template made protruding amino acids (open complex). The same three subunits were denoted by A, B and C with few amino acid positions were described.
Figure 11:
Swiss-Modelling of XEC spike (Front view) and compared with LB.1.7 spike and
KP.3.1.1 spike using best fit 7cn8.1.A template and 8y5j.1.A templatel. The
best symmetrical oligomeric 3D spike structure was found with 7cn8,.1.A
template and XEC spike but very comparable.
Figure 12: Open complex of single subunit coronavirus spike of Wuhan (B.0), XEC and KP.3.1.1. The XEC and KP.3.1.1 had some sword conformation at the RDB (see arrow) useful for better binding to lungs cells. Such up conformation in XEC and KP.3.1.1 favors ACE-2 binding (Zhao et al., 2022).
Table 1: Spike protein amino acid point mutations in Omicron JN.1 coronavirus (protein id. WUY16791) as BLASTP-2 compared with Wuhan spike.
|
POS |
19 |
21 |
27 |
50 |
127 |
142 |
157 |
158 |
177 |
212 |
213 |
216 |
245 |
264 |
332 |
339 |
356 |
371 |
373 |
375 |
376 |
403 |
405 |
408 |
417 |
440 |
445 |
446 |
450 |
|
B |
T |
R |
A |
S |
V |
G |
F |
R |
M |
L |
V |
L |
H |
A |
I |
G |
K |
S |
S |
S |
T |
R |
D |
R |
K |
N |
V |
G |
N |
|
J |
I |
T |
S |
L |
F |
D |
S |
G |
I |
I |
G |
F |
N |
D |
V |
H |
T |
F |
P |
F |
A |
K |
N |
S |
N |
K |
H |
S |
D |
|
POS |
452 |
455 |
460 |
477 |
478 |
481 |
484 |
486 |
498 |
501 |
505 |
614 |
621 |
655 |
679 |
681 |
764 |
796 |
939 |
940 |
969 |
1143 |
|
|
|
|
|
|
|
|
B |
L |
L |
N |
S |
T |
N |
E |
F |
Q |
N |
Y |
D |
P |
H |
N |
P |
N |
D |
S |
Q |
N |
P |
|
|
|
|
|
|
|
|
J |
W |
S |
K |
N |
K |
K |
K |
P |
R |
Y |
H |
G |
S |
Y |
K |
R |
K |
Y |
F |
H |
K |
L |
|
|
|
|
|
|
|
Table 2: Characteristics of few recombinant corona viruses (2019-2024).
|
No |
Variant |
Recombinant
variants |
Accession
numbers of important corona viruses that had gone recombination |
Actual
name of the coronaviruses |
|
1 |
XAM |
AY.122 + BA.2 |
AY.122=OQ119975/OQ119980 BA.2=OP633365/OQ030587/OQ028416 |
BA.2=B.1.1.529.2 Delta=AY.122 |
|
2 |
XAJ |
BA.2.12.1 + BA.4 |
BA.2.12.1=OQ098129/OQ098131/ON386383 BA.4=OP825918 |
BA.2=B.1.1.529.2 BA.4=B.1.1.529.4 |
|
3 |
XBC |
BA.2 + B.1.617.2 |
BA.2=OM901219 B.1.617.2=OM265438/OP599775/OK465723 |
BA.2=B.1.1.529.2 Delta=B.1.617.2 |
|
4 |
XBF |
BA.5.2 + CJ.1 |
BA.5.2=OP936468/OQ097528/ON999606 CJ.1= |
CJ.1=BA.2.75.3.1.1.1.1 BA.5.2=B.1.1.529.5.2 |
|
5 |
XDQ |
BA.2.86.1 + FL.15.1.1 |
FL.1=OR252031 FL.15=OR251957 |
FL.1=XBB.1.9.1.1 FL.15=XBB.1.9.1.15 |
|
6 |
XBB |
BJ.1 + BM.1.1.1 |
XBB=OQ080149/OX394639 BA.2.75=OP699966 BM.1.1.1=OQ253574 |
BJ.1->BA.2.10.1 BM.1.1.1-> BA.2.75 |
|
7 |
XEC |
KP.3.3 + KS.1.1 |
XEC=PQ313310/PQ380322 KS.1.1=PQ380361/PQ345743 KP.3.3=PQ380374/PQ206638 |
KS.1.1=JN.1.13.1.1.1 KP.3.3=JN.1.11.1.3.3 |
Table 3: Penetration of KP.3.2, KS.1.1 and XEC amino acid point mutations in GenBank database
|
Protein id |
BLASTP sequence
(First 60 amino acids of spike protein) |
Penetration
(GenBank) |
|
1. XEQ88390 |
Mfvflvllplvssqcvmplfnlitttqsytnsftrgvyypdkvfrssvlhltqdlflpfs-60 |
650 |
|
2. XEQ89525 |
Mfaflvllplvssqcvmplfnlitttqsytnsftrgvyypdkvfrssvlhltqdlflpfs-60 |
1 |
|
3. XGE36110-KS.1.1 |
Mfvflvllplvssqcvmplfnlittnqsytnsftrgvyypdkvfrssvlhltqdlflpfs-60 |
130 |
|
4. XGE36098-KP.3.3 |
Mfvflvllplvssqcvmplfnlitttqsytnsftrgvyypdkvfrssvlhltqdlflpff-60 |
>5000 |
|
|
|
|
|
5. XGD20832-K1081R |
Grahfpregvfvsngthwfltqrnfyepqiittdntfvsgncdvvigivnntvydplqle-1140 |
>2050 |
|
6. XGZ36098-KP.3.3-Q489E |
Gpncyfplesygfrptygvghqpyrvvvlsfellhapatvcgpkkstnlvknkcvnfnfn-540
|
>4000 |
|
7. V1l00L-A1082S |
Chdgkshfpregvfvsngthwfltqrnfyepqiittdntfvsgncdvvigivnntvydpl-1138 |
20 |
|
8. A599T XHN31935 |
arvvrsifsrtletaqnsvrvlqkaaitildgisqyslrlidammftsdlatnnlvvmty-600
|
495 |
Table 4: Parameters of SWISS-MODELLING of XEC variant Spike Protein of SARS-CoV-2
|
Model-1:
Parameters of Swiss-Modelling between XEC spike protein (red) and compared
with JN.1 (green), LB.1.7 (Blue) and KP.3.1.1 (yellow) variants using
template 8wly.1.B (Bat origin) |
||||||||
|
Protein id |
QMQE |
QSQE |
Identity |
MolProbity score |
Clash score |
Ramchandran favoured |
Bad bonds |
Bad angles |
|
XDF23570 |
0.69 |
0.99 |
74.64% |
1.67 |
1.11 |
88.42% |
1 |
214 |
|
XHC86854 |
0.68 |
0.99 |
74.49% |
1.61 |
0.63 |
87.51% |
0 |
219 |
|
XEQ70659 |
0.68 |
0.99 |
74.63% |
1.75 |
1.69 |
88.44% |
2 |
244 |
|
XHP24317 |
0.63 |
0.99 |
74.27% |
1.69 |
1.19 |
88.27% |
|
|
|
Model-2:
Parameters of Swiss-Modelling between JN.1, XEC and LB.1.7 spike protein
variants using template 7cn8.1.A (Pangoline origin) |
||||||||
|
Protein id |
QMQE |
QSQE |
Identity |
MolProbity score |
Clash score |
Ramchandran favoured |
Bad bonds |
Bad angles |
|
XDF23570 |
0.68 |
0.97 |
88.90% |
1.45 |
0.90 |
94.90% |
0 |
125 |
|
XHC86854 |
0.68 |
0.97 |
88.74% |
1.37 |
0.67 |
95.02% |
5 |
110 |
|
XEQ70659 |
0.68 |
0.97 |
88.72% |
1.48 |
0.94 |
94.66% |
0 |
151 |
|
XHP24317 |
0.69 |
0.96 |
88.23% |
1.44 |
0.84 |
94.9% |
0 |
126 |
|
Spike
protein Swiss Modelling parameters of XEC variant omicron corona virus using
8y5j.1.B template |
||||||||
|
Protein id
|
QMQE |
QSQE |
Identity |
MolPrabity score |
Clash score |
Ramchandran favoured |
Bad bonds |
Bad angles |
|
XHC86854 |
0.63 |
0.92 |
99.00% |
1.30 |
0.48 |
90.13% |
7 |
188 |
|
XEQ70659 |
0.66 |
0.93 |
99.08% |
1.21 |
0.45 |
89.90% |
1 |
181 |
|
XHP24317 |
0.66 |
0.92 |
99.07% |
1.27 |
0.68 |
90.06% |
2 |
172 |
The XEC variant was originated from KP.3.3 and KS.1.1
JN.1 lineages but we showed that FL.15 subvariant was also involved in the
process [25-27]. In otherwards, spike N-terminal amino acid sequence from
KS.1.1 made the XEC virus more unique. So far spike amino acids 315-510 (RBD
domain) have been implicated in ACE-2 binding. With our model, we have seen the
modulation of surface interacting spike amino acids in omicron variants
[28]. Indicated universal mutation G142D
and common mutation Q146H and R158G as well as A83V to A83F, V90L to V90Y in
the NTD domain and T346R/ T346I in the RBD domain of spike of JN.1 variant
would possibly contribute to the ongoing evolution of viral lineages, and their
overall fitness and adaptability [29]. Coronavirus replicative RNA
recombination may be involved in the entire genome [30]. Non-replicative RNA
recombination of an animal plus-strand RNA virus might be possible in the
absence of efficient translation of viral proteins and solely mediated by
cellular recombination proteins [31]. Certainly, RNA virus populations are
diverse due to a variety of factors, including lack of proofreading of the
viral RNA-dependent RNA polymerase (RdRP) [32]. There are 11 shared common
mutations G339D, S373P, S375F, K417N, N440K, S477N, T478K, E484A, Q493R, Q498R,
and N501Y in RBD Omicron sub?variants that may contribute significantly to
change the host spectrum of SARS?CoV?2 in immune evasion and potential
transmission. The BA.1 variant has 18 unique mutations A67V, H69del, V70del, T95I,
V143del, Y144del, Y145del, N211I, L212V, V213R, ins214EP, R216E, S371L, G446S,
G496S, T547K, N856K, and L981F. Whereas, BA.2 has 10 unique mutations T19I,
L24del, P25del, P26del, A27S, V213G, S371F, T376A, D405N, and R408S. The
Omicron sub?variants (BA.1.1, BA.2 and BA.3) are likely more transmissible than
omicron (BA.1) and Delta. This may facilitate RBD interaction with the
negatively charged ACE2, hence enhancing the ACE2 receptor's affinity [33].
Kumar et al also predicted that the T95I, N211I, and V213R mutations to be
deleterious in BA.1 while Y505H, N786K to be deleterious both BA.1 and BA.2 for
ACE-2 interactions. Parsons and Acharya recently reported that omicron trimeric
3-D spike structure was more compact to interact with ACE-2 receptor. They have
not used the 3-D JN.1 or XEC spike proteins and have compared the 3-D structure
with PDB IDs; Alpha, PDB: 7R13; Beta, PDB: 7LYL; Delta B.1.617.2, PDB: 7TOU;
D614G, PDB: 7KDK; BA.1, PDB: 7TL1; BA.2, PDB: 7UB6. Important question if the
three RBD domains are down or one RBD is up to interact first with ACE-2
receptor as postulated with recent JN.1 omicron viruses. According to deep
mutational scanning, ELISA, and SPR analysis, some of these mutations increased
affinity for ACE-2 (N440K, S477N, T478K, G496S, Q498R, N501Y) while others
decreased ACE-2 affinity (R346K, K417N, G496S, E484A, G496S, Y505H) [34]. We
postulated His442, Pro482, Lys480, Lys478 might be involving amino acids to
first interact with ACE-2 receptors. The 31S deletion decreases nAb titers of
LB.1, KP.2.3 and KP.3.1.1 in bivalent mRNA-vaccinated healthcare workers and
causes escape of antibodies in BA.2.86/JN.1-wave convalescent sera [12]. The
JN.1 subvariants, including LB.1, KP.2.3, and KP.3.1.1, are completely
resistant to neutralization by S309, one of the most broadly neutralizing
antibodies have tested. The Q493E mutation in KP.3.1.1 was thought to be
important for recent higher infectivity of KP.3.1.1 similar to L455S and F456L
enhanced the ACE-2 binding. Mutations within CD8+ epitopes in N protein (M322I
and L331F), M protein (L90F) and the spike protein (L270F) and Nsp3 T504P were
reported within minority variants during the course of acute infections,
resulting in loss of epitope-specific responses and pathogenesis [10]. The M-protein
I82T and N-protein R203M/R203K mutations were also reported worldwide [35]. We
found D3H, A63T and A104V mutation in the M-protein of JN.1 variants. Thus,
convergent evolution in JN.1 subvariants with R346, L455, and F456 mutations in
the RBD of spike has further exacerbated immune escape, underscoring an urgent
need for updated vaccine development during 2024 [36]. Interestingly, Paxlovid
drug was quite satisfactory reducing the symptoms of omicron coronaviruses
[37,38]. Surely, XEC and KP.3.1.1 should be studied more carefully using whole
genome sequencing and new vaccine development with modified spike must be
continued.
We concluded and reviewed the genesis of XEC variant and KP.3.1.1 variant that had favorable compact 3-D conformation for higher transmission. The main differences XEC variant had no 31S deletion in spike while most KP.3.1.1 and LB.1.7 variants had 31S spike deletion. The important 17MPLF spike insertion was found in most (>95%) omicron JN.1 lineages. The 49nt deletion in the 3’-UTR of JN.1-related variants is minimum (<1%) and few scientists are not sequencing that region as getting conflict data.
Acknowledgement
We thank free CLUSTAL-Omega software, free Swiss Model
server and free SARS-CoV-2 Database (NIH, USA). AKC is a retired associate
professor.